SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000307863 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000307863
Domain Number 1 Region: 633-775
Classification Level Classification E-value
Superfamily ENTH/VHS domain 2.18e-57
Family ENTH domain 0.000000182
Further Details:      
 
Domain Number 2 Region: 329-420,452-531
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.15e-27
Family Canonical RBD 0.000012
Further Details:      
 
Domain Number 3 Region: 222-306
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.48e-18
Family Canonical RBD 0.00000685
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000307863
Sequence length 904
Comment U2AF2 (Homo_sapiens) U2 small nuclear RNA auxiliary factor 2
Sequence
MKRAPSAHGKDLWNQRERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSASRDRRR
RSKPLTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAPGPSGGRA
QRSGSYQVVSCCWAESSLACWSCRTAAQSCRSPRHEKKKKVRKYWDVPPPGFEHITPMQY
KAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMD
FFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIR
RPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKA
FNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTI
NQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGL
VKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVALQNTAVDGSDE
EALVTLALVPEVMPPGRVWLRKPELPRPGDFCLQKLGFLSDVEVFTALPRRLLPSRVRCG
DLPALCVDNPCDCHTSGRPRGPEPLNFTTGTMSTSSLRRQMKNIVHNYSEAEIKVREATS
NDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGS
ERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALK
TKEKLAQTATGCRVPPRLPPSLTLGVLPIAFVLLHMCASFESSFAVGGSAEERIRRGDDL
RLQMAIEESKRDTGGKEEPTASCQAGPPLCLSWLGALVPVISHMCLWQLMLLLVIFPFGS
IVWD
Download sequence
Identical sequences G5BVY1
HGL_H00000307863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]