SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000308080 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000308080
Domain Number 1 Region: 326-412
Classification Level Classification E-value
Superfamily GTF2I-like repeat 2.22e-30
Family GTF2I-like repeat 0.001
Further Details:      
 
Domain Number 2 Region: 102-192
Classification Level Classification E-value
Superfamily GTF2I-like repeat 1.7e-29
Family GTF2I-like repeat 0.00095
Further Details:      
 
Domain Number 3 Region: 532-941
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000022
Family Hermes transposase-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000308080
Sequence length 946
Comment GTF2IRD2B (Homo_sapiens) GTF2I repeat domain containing 2B
Sequence
MAQVVMPTLPGEDAEPSESRMVVTFLVSALESMCKELAKSKAEVACIAVYEADVFVVGTE
RGRAFVHARADLQKDFAKYCAAEGLAEEKPPRPASGVQVSSGEVETLRKAVEDHFGLCYG
RALGTMTTVPVPYEQMLRDPAAVMVQGLPEGAALQHPENYDLPTLKWVLEHKAGISFVIN
RPFLGMESQLGDHGTVTDAKRSMLSPKASYVPISVKTEPLEDTGISLKAEAVTIKKEAED
PNYYHCSMAGSHLSSTSSEVIETESPMEESTQPFSSEASEDPEGNVKIKGNPDSRGITAS
ASGVEELNIVQVAVPDNEKERLSSIEKIKQLREQVNDLFSRKFGEAIGVDFPVKVPYRKI
TFNPGCVVIDGMPPGVVFKAPGYLEISSMRRILDAAEFIKFTVIRPLPGLELSNVGKRKI
DQEGRVFQEKWERAYFFVEVQNIPTCLICKQSMSVSKEYNLRRHYQTNHSKHYDRYTEQT
RDAKLEELKSGLHRYLLGPSDMVCTEPRLPSVSLPENIEVQPVEDVAGNPWEKLREKIKL
FVAYSIAIDEITDINNTTQLAIFIRGVDENFDASEELLDTVPMTGTKSANEIFARVEKSL
KKFNIDWSKLVSVASTGTPAMVDANNGLVTKLKSKVATCCKGSDLKSVCCIIHPESLCAQ
RLQMDHVMDVVVSSVNWICSRGLNHSEFTTLLYELDSQYGRLLYHTGIKWLSRGLVLKRF
FESLEEIDNFLSSRGKPVPQLSSGDWIRDLAFLVDMTTHLNTLNVSLQGHSQIVTQMYDL
IRAFVAKLCLWETHLARNNLAHFPTLKSVSQNESDGLNYIPRIEELKSEFQRRLSDFKLY
EGELTLFSSPFATKIDSVREELQMEVIDLQCNTVLRAKYDKVGVPEFYKYLWSSYPRYRR
HCAKILSMFGSTYICEQLFSIMKLSKTKASSQLQAPQWDSMLHMAT
Download sequence
Identical sequences G5C6B2
HGL_H00000308080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]