SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000308541 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000308541
Domain Number 1 Region: 334-536,578-631
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.7e-71
Family Eukaryotic proteases 0.0000000119
Further Details:      
 
Domain Number 2 Region: 105-196
Classification Level Classification E-value
Superfamily Kringle-like 2.37e-32
Family Kringle modules 0.0000108
Further Details:      
 
Domain Number 3 Region: 211-297
Classification Level Classification E-value
Superfamily Kringle-like 2.01e-26
Family Kringle modules 0.0000388
Further Details:      
 
Domain Number 4 Region: 45-102
Classification Level Classification E-value
Superfamily GLA-domain 4.04e-19
Family GLA-domain 0.0000852
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000308541
Sequence length 652
Comment F2 (Homo_sapiens) coagulation factor II (thrombin)
Sequence
MVHVGGLQRPGCLALAALLSLAVGQDVFLAPNRAKSLLQRTRRANSGFLEELRRGNLERE
CVEEQCSYEEAFEALESSSATDVFWAKYTACESVRKPRETLMECLDGHCAKGLGMNYRGT
VNATRSGIECQLWSSRYPHRPEVNHTTHPGADLLENFCRNPDGSTTGPWCYTTDPTVRRE
ECSVPVCGEARFTVEMTPRSGGSRPDVSSSLADCVPQRGRQYQGRLAVTSKGSPCLPWAS
EQARSLSQDKDFSPEVKLEENFCRNPNKDEEGAWCFVAGESSHIQYCDLNYCEEAVEEAV
EEAIGGRTTTEDFQTFFEEQTFGLGEAAQLLDSYIDGRIVEGWDAETGVAPWQVMLFRKT
PQELLCGASLISDRWALTAAHCVLYPPWDKNFTENDLLLRIGKHSRSRYERNMEKISMLE
KIFIHPRYNWRENLDRDIALLKLKRPVPFSDYIHPVCLPDKQTVVSLLQAGYKGRVTGWG
NLREVWKSSAGEVQPSVLQLVNLPIVDRPTCRSSTRIRITDNMFCAGKFQTGKAGPSLAF
EFHRSADPSVLATKWTRPDSVLSAGFKPEEGKRGDACEGDSGGPFVMKNPFNNRWYQMGI
VSWGEGCDRDGKYGFYTHVFRLKKWIQKVIERFGGPAPTAVSPRRRRHQPTQ
Download sequence
Identical sequences G5ATC4
HGL_H00000308541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]