SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000308897 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000308897
Domain Number 1 Region: 18-83
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 3.53e-24
Family Ribosomal L11/L12e N-terminal domain 0.00037
Further Details:      
 
Domain Number 2 Region: 80-155
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 4.06e-17
Family Ribosomal protein L11, C-terminal domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000308897
Sequence length 192
Comment MRPL11 (Homo_sapiens) mitochondrial ribosomal protein L11
Sequence
MSKLSRASRAVRKPEAGGLIRTIVRAGQAMPGPPLGPVLGQRGVSINQFCKEFNEKTKDI
KEGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGMVTLKHIYEI
ACIKARDDAFALQDAPLSSVVRSIIGSARSLGIRVVKDLSAEELAAFQKERAEFLAAQRE
ADLAAQAEAAKK
Download sequence
Identical sequences G5BWY1
XP_004852361.1.39548 HGL_H00000308897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]