SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000308938 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000308938
Domain Number 1 Region: 609-826
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.62e-65
Family Eukaryotic proteases 0.0000000946
Further Details:      
 
Domain Number 2 Region: 369-464
Classification Level Classification E-value
Superfamily Kringle-like 9.18e-38
Family Kringle modules 0.0000139
Further Details:      
 
Domain Number 3 Region: 272-356
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-36
Family Kringle modules 0.0000284
Further Details:      
 
Domain Number 4 Region: 90-184
Classification Level Classification E-value
Superfamily Kringle-like 1.72e-34
Family Kringle modules 0.0000187
Further Details:      
 
Domain Number 5 Region: 183-267
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-34
Family Kringle modules 0.0000151
Further Details:      
 
Domain Number 6 Region: 500-606
Classification Level Classification E-value
Superfamily Kringle-like 7.97e-29
Family Kringle modules 0.0000255
Further Details:      
 
Domain Number 7 Region: 22-100
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 3.53e-20
Family Hairpin loop containing domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000308938
Sequence length 828
Comment PLG (Homo_sapiens) plasminogen
Sequence
MDHKEVILLFLLFLKSGQGISQDDYENTRGASLVSLTKKQLGAANIDECAAKCEEETEFV
CRSFQYHSKEEQCVIMAENSKSSPIIRMRDVILFEKKVYLLECRTGNGKNYRGTMSRTKS
GVTCQKWGATFPHRPNYSPGTHPAEGLENNYCRNPDNDPEGPWCYTTNPDKRYDFCDIPE
CEDECMHCLGENYMGKISTTVSGLECQAWDSQVPHAHGFIPSKHPNKNLKMNYCRNPDGE
LRPWCFTTDPNKRWEFCNISRCTTPPPPPGPVYQCLKGRGENYRGKVAVTVSGRTCQRWS
EQTPHKHNRTPENYLCKDLEENYCRNPDRETAPWCYTTDSKVRWEYCAIPSCESSQLSAE
HSDGPALPEQTPVVQECYHGNGQSYRGTSSITVTGKKCQSWSSVRPHVHGKTPENYPNAG
LTMNYCRNPDVDKSPWCYTTDPSVRWEYCNLKKCSETEGSVVESQTTAQVPSVQATSEPA
LQGSDGCDTESVTLQQHSSFAFIAYWIYVVAHCMVGYGKEYRGKMATTVAGIPCQGWADQ
EPHKHRIFTPESNPQAGLEENGVVSQVPASFQYCRNPDGDFSGPWCYTMSPTKLYDYCDV
PQCAPSSYDCGKPRVEPKKCPGRVVGGCVANPHSWPWQVSLRTRSLNPAFYKVILGAHQE
INLESNVQRKDVTKLFLEPHRADIALLKLSSPAVITDKIIPACLPSSNYMVADRTLCYIT
GWGETKGTYGAGLLKEAQLPVIENKVCNRFEYLNGRVKPTELCAGHLAGGTDSCQGDSGG
PLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSTFVKWIEEIMGTN
Download sequence
Identical sequences G5BC53
HGL_H00000308938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]