SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000309052 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000309052
Domain Number 1 Region: 477-706
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.18e-33
Family Voltage-gated potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000309052
Sequence length 816
Comment CATSPER1 (Homo_sapiens) cation channel, sperm associated 1
Sequence
MGEPSMTEQAQNEHNTNNLDILSQSYSSLLHHRPEHDRPHHPYESLHLRGGHHHGESQHH
RESHQDFHESAFPHSHHGKAHPHDRSHHPTCLGWAHSSAIIHSHHSYGEDHFDDEHHYGS
TIQHGGSHHHTELYHHVGGHHGGPHHHTESYHHDGPHHHTESDHHGGPHHHGRHHYYGGH
QHHQSSGVSYQHGETSYLSRFHLPGVLPHPGEYGHHGGIHHQSPSYRHEDSYHSGGPYHH
SEDYHYSGSQHHEPHQHNRLHPHESHHHRKHLHHGERLLKHPSEESYHHGTPYFHGESYH
GNHRSSEDHHGEHHHHGDHHHGEHHHHGEHHHGEHHHHREHHHQEHHHSAHRYDHLHSNS
YRDYRRSSSQHFVPHKPHSITDSTPHLELTKSLPHSKQSYTGARSRGSLASNKVHPQDTS
SKDSESWSEDKQYQRQKRGRAQRAHKKHAMNIFQRLSEKLRTLLWGPWTIIRSLTQSLVF
ETFIFLIVFLNIIMLMAQTFAEVKIRGEWYFMAFDCIFLSIYIIEALLKIISLGLQYFYD
PWNNLDFFVVVMAVLDFLLMQVNSLFSFYNHSLFRILKVLKIMRALRAIRIVRRLRILTS
LKEVTGTLVGSLLSIITIFILIFSCLLFFSMILTLFRRSDPWRFENFFTTMFTLFTVLTL
DDWSLIYMDSRAQGAWYIIPILMIYIFIQNIIFLNLLTAVLVDNFQMALLRDEEKVKQEM
TAWIHEKLLDDSLMELNQTEPEEVKSEDTMQFMKKFGTVTEKQWEFQAPFLKLVARLEHH
RQKFSSGARIIDEIVDTTFKVSQRTSRSDPGEQHQV
Download sequence
Identical sequences G5BWW6
HGL_H00000309052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]