SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000309186 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000309186
Domain Number 1 Region: 404-489
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-21
Family SH3-domain 0.00086
Further Details:      
 
Domain Number 2 Region: 115-181
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-19
Family SH3-domain 0.00085
Further Details:      
 
Domain Number 3 Region: 759-819
Classification Level Classification E-value
Superfamily SH3-domain 4.86e-17
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 4 Region: 177-239
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000827
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000309186
Sequence length 821
Comment SH3RF3 (Homo_sapiens) SH3 domain containing ring finger 3
Sequence
MGCRAAKRGYMVAVGSEDADQKAQAELDRDAQDPQGDWSASSRDLSLNPDPGPPLDITWG
LASQEVSLVLHLEDESASSRDLSLNPDPGPPLDITWGLASQEVSLVLHLEDESLSQLPYG
KALYSYEGKEPGDLKFNKGDVIILRRRVDEHWFHGELHGTRGFLPASYVQCLRPLPQAPP
QGTALYDFEMKDRDQDQDCLTFTKDEVLTVIRRVDDNWAEGMLGDRIGIFPLLYVQHRPG
FSILLLKMRTYHMNTNCQLNDSAKQLIEMDKLCPAAAAASSCAVPLPSDASTVASAGLGP
TAGSSGAVSAFQRRMDSKKNAKKRHSFTALSVTHKSSQAVTHRHSMEISAPVLISSSDPR
AAARIGELTHPPCSMPAQDPCSAGPVPTAVPRASTAAGEQGTSPKVPLPLNVYLALYAYK
PQKSDELELRKGEMYRVLEKCQDGWFKGASMRTGLSGVFPGNYVTPISRAPGGAAGPPRN
SALGGSPLAKGMATTMHPGGGSLSRPALPLTTPQAQAPHPAGSPPTGSCPHHTAQPATGQ
TRGALSAAAHPSAQAQDRPTATVTPLRTQSSPSRLPTTSLRPRSMVSPQPGQQSPVQTSP
RPAIPFTSAASAITPPSVSTTSLSGDAGGGSSGGLSTSSPTSTGCRLEDKRGEKKEKKSG
LLKLLAGASTRRKSRSPPSFSPTHDPLVATDTSLLGATGPDMSSLSVHGRAGSCPIESEM
RGAMGLEPLHRKTGSLDLNFCSSPARQAALSTAAIRPEPKPLPRERYRVVVSYPPQSEAE
IELKEGDVVFVHRKRKDGWYEGTLQRNGRTGLFPGSFVESF
Download sequence
Identical sequences G5CB95
HGL_H00000309186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]