SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000309597 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000309597
Domain Number 1 Region: 113-376
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-75
Family Protein kinases, catalytic subunit 0.000013
Further Details:      
 
Domain Number 2 Region: 39-109
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-20
Family SH3-domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000309597
Sequence length 848
Comment MAP3K11 (Homo_sapiens) mitogen-activated protein kinase kinase kinase 11
Sequence
MEPLKNLFLKSPLGSWNGSGSGGTGGGGGAWPEGSPKAAAYANPVWTALFDYEPSGQDEL
ALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGPPPCEVASFQELRLE
EVIGIGGFGKVYRGSWRGELVAVKAARQDPDEDISVTAESVRQEARLFAMLAHPNIIALK
AVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVLVNWAVQIARGMHYLHCEALVPVIHR
DLKSNNILLLQPIEGDDMEHKTLKITDFGLAREWHKTTQMSAAGTYAWMAPEVIKASTFS
KGSDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKLTLPIPSTCPEPFAQLMADCWA
QDPHRRPDFASILKQLEALEAQVLREMPRDSFHSMQEGWKREIQDLFDELRAKEKELLSR
EEELTRAAREQRSQAEQLRRREHLLAQWELEVFERELTLLLQQVDRERPHVRRRRGTFKR
SKLRARDGGERISMPLDFKHRITVQASPGLDRRRNVFEVGAGDSPTFPRFRAIQLEPAEP
GQAWGRQSPRRLEDSSNGERRACWAWGPSSPKPGEVQNGRRRSRMDEATWYLDSNDSSPV
GSPSPPPTLNGNPLRPSPEPEEPRKPGATERGSSSGTPKLIQRALLRGTALLASLGLGRD
LQPPGGLGRERGEPPPAPPAPATCPAATEAPPTPIIHLSPKMPNTHGLPSPVPLLLDLSV
SAGQPSAKSPRREETHGGTVSPPPGISRSAPGTPGTPRSPPLSLISRPRPSPLRSRIDPW
SFVSAGPRPSPLPSPQPVPRRAPWTLFPDSDPFWDSPPANPFRGGPQDCRAQTKDMGAQA
PWAPEAGP
Download sequence
Identical sequences G5B6J9
HGL_H00000309597 XP_004852446.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]