SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000309809 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000309809
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily Macro domain-like 2.52e-30
Family Macro domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000309809
Sequence length 287
Comment MACROD2 (Homo_sapiens) MACRO domain containing 2
Sequence
VIHTVGPIARGHINGSHKEDLANCYKSSLKLVKENNLRSVAFPCISTGIYGFPNEPAAVI
ALGTIKEWLAKNHQEVERIIFCVFLEVDFKIYKKKMSEFFPMDDNNEEEDADMKEESDEN
GPEEKQSAEEIEGQSQEADGVNTATVPSPGTEETVEVCKDKESEKDDNIIKDITDHSVVD
QDRPNGEENDSTKNEIKIKTESQSSYMETEEPSSNQEDATIVEQPEVIPLTDDQDEKEGA
NAQGEDTPTASVKSQSSSDTEPATGPDVEMNSQVDSVNDPTESQQED
Download sequence
Identical sequences G5AMI0
HGL_H00000309809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]