SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000310244 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000310244
Domain Number 1 Region: 233-583
Classification Level Classification E-value
Superfamily Ras GEF 9.15e-94
Family Ras GEF 0.00051
Further Details:      
 
Domain Number 2 Region: 644-712
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.78e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0012
Further Details:      
 
Domain Number 3 Region: 491-510,579-649
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000334
Family Calmodulin-like 0.036
Further Details:      
 
Weak hits

Sequence:  HGL_H00000310244
Domain Number - Region: 867-903
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0562
Family Mitotic arrest deficient-like 1, Mad1 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000310244
Sequence length 917
Comment RASGRP1 (Homo_sapiens) RAS guanyl releasing protein 1 (calcium and DAG-regulated)
Sequence
MISPSLGPVSSASQALPCPMGSGSKLMSRILQDCGVTFMEAKIHALMKAAGVSTELLGPG
FLAMALASAQMGHLPLRDWKPCHGSRAAPKARLEAKPASSPFPSHPSLAQITQFRMMVPL
GPLAKGASLDDLIDSCIQSFALRGGHYLAPLSNMELNSASYCADVLEDYESQVTDTRLSC
GLVGDQVLYSAERCKRKGKKTYQVRGALKCLLASLSALNLCGLAARLPTYKGALAKNSPG
VCLKICYFVRYWITEFWIMFKMDASLTNTMEEFQELVKANGEESHCCLIDTTQINARDWS
RKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNRCVKE
NPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIHVAQKLHQLQNFNTLMAVIGG
LCHSSISRLKETSSHVPHEINKVLSEMTELLSSCRNYDNYRRAYGECTHFKIPILGVHLK
DLISLYEAMPDHLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLF
YTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFK
NYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGF
PHSFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRTKNPAA
PTENTTSVAPTSNLCSLGARDLLHAPEEGSFTFLNGEAVEHSEESKDRTIVLMGVSSQKI
SVRLKRTVAHKTTQTESLPWLGSEGPSGHFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVR
KRAFVKWENKESLLKSKEELRHLRLPSYQELEQEINTLKADNDALKIQLKYAQKKIESLQ
LEKSNHVLAQMEQSDCS
Download sequence
Identical sequences G5C7D1
HGL_H00000310244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]