SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000310471-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000310471-2
Domain Number 1 Region: 77-169
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.02e-20
Family Canonical RBD 0.012
Further Details:      
 
Domain Number 2 Region: 3-74
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.49e-19
Family Canonical RBD 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000310471-2
Sequence length 333
Comment RBM4B (Homo_sapiens) RNA binding motif protein 4B
Sequence
MVKLFIGNLPWEASEQEICSLFEQYGKVLESGIIKNYGFVHIEDKTAAEDAIRNLHHYKL
YGVNINVEASKNKSKASTKLHVGNISPTVTNQGLRGKFAEYGPVIKCDIVKDYAFVHMEQ
AEDEVEAIRGLDDTEFQGQRVYVQLSISSLWTAPGMGEQSGCYRCGKEGHWSEECPVDPT
GHVGDFTEQYNEQHGAVHTPYTMGCGESVNYNDAYGALNYYKRYLVRSYEAVAAAAAASA
YSYADQTMSHLPQVQSSAVTSHLNSTSVDPYDRHPLPNSGAAATFSSFYGRDRSPLHRAA
AVLPTVGEGCGYGPESELTQASAAARNSLYDVA
Download sequence
Identical sequences G5BIW4
HGL_H00000310471-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]