SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000310472 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000310472
Domain Number 1 Region: 647-704
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 480-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 311-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.98e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 50-109
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-24
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 5 Region: 535-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.62e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 703-760
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 759-816
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.38e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 367-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-22
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 9 Region: 591-648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 10 Region: 423-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.73e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 11 Region: 801-853
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 12 Region: 273-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000310472
Sequence length 864
Comment ZNF624 (Homo_sapiens) zinc finger protein 624
Sequence
MALQNSTLSKEENTEAEIMAAVVFSVGPLNPEITHPHENLHLQAEEAELVKESVTFKDVA
IDFTLEEWRLMDPTQRKLHKDVMLENYRNLASLGLAVSKPDMISHLENGKGPWTVVRKIS
RTPYPDLETKPATKNAVLTEDIFEGLSQEIIVEKLRENGLWDSTMGGLWKWSDRIFRWQN
SQESHLNQRLVTHRKTPTGQKGFRFGSPPTEPGIITEESHGKCQIHEESFTENLDLIADD
HLGKIIYKNTEGSKTLRQISELTLGKKSNNEEKPYKCSTCQKAFRYRSLFIQHQRTHTKE
KPYECNECGKTFSQPSYLSQHKKIHTGEKPYKCNECGKAFIASSSLMVHQRIHTKEKPYQ
CNVCGKSFSQCARLNQHQRIQTGEKPYKCSKCGKAFSDKSKLSRHQETHNGEKPYKCNDC
GKSFRNKSYLSVHQKTHTEEKPYKCHECGKSFKNTTIFNVHQRIHTGEKPFRCNECGKAY
RSNSSLIVHVRTHTGEKPYVCNECGKAFNRIANFTEHQRIHTGEKPYKCNECGKAFINYS
CLTVHHRMHTGEKPYKCNECGKAFMRSSSLIIHQRIHTEEKPYLCNECGESFRIKSHLTV
HQRIHTGEKPYKCTDCERAFTKMVNLKEHQKIHTGVKPYTCYDCGKSFRTKSYLIVHQRT
HTGEKPYKCNECEKAFTNTSQLTVHQRRHTGEKPYKCNECGKVFTSNSGFNTHQRTHTGE
KPFKCNDCGKAFSQMVHVTEHQKIHSGEKPYKCDVCGKAFRRGSYLTVHWRTHTGEKPYT
CKECGKGCITLSQLTLHQRIHTGERPYKCEECGKAFRTNSDFTVHLRMHTGEKPYKCNEC
GKAFRSSSSLTVHQRIHQRDAQLV
Download sequence
Identical sequences G5BQZ7
HGL_H00000310472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]