SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000310572 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000310572
Domain Number 1 Region: 278-528
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.94e-71
Family Extended AAA-ATPase domain 0.00000164
Further Details:      
 
Weak hits

Sequence:  HGL_H00000310572
Domain Number - Region: 53-82
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00126
Family RILP dimerisation region 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000310572
Sequence length 545
Comment PSMC5 (Homo_sapiens) proteasome (prosome, macropain) 26S subunit, ATPase, 5
Sequence
MWTNPDQGLPETGFAVSAPPAMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQA
QRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDIND
VTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIEL
PVKQQKAGDTKEKLVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDK
NIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEI
KEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQ
KFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLD
GFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRG
INLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSI
KKLWK
Download sequence
Identical sequences G5BDI9
HGL_H00000310572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]