SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000311121 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000311121
Domain Number 1 Region: 4-217
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.85e-75
Family Proteasome subunits 0.0000000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000311121
Sequence length 221
Comment PSMA8 (Homo_sapiens) proteasome (prosome, macropain) subunit, alpha type, 8
Sequence
MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTVVGIRGTNIVVLGVEKKSVAKLQDERT
VRKICALDDHVCMAFAGLTADARVIINRAQVECQSHKLTVEDSVTIEYITRFIATLKQKY
TQSNGRRPFGISALIVGFDDDGIPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYSE
DAVSNDSEAIKLAIRALLEVVQSGGKNIELAIIRRNQPLKV
Download sequence
Identical sequences G5BJS1
HGL_H00000311121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]