SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000311196 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000311196
Domain Number 1 Region: 220-300
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000157
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0095
Further Details:      
 
Domain Number 2 Region: 81-151
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000655
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.06
Further Details:      
 
Weak hits

Sequence:  HGL_H00000311196
Domain Number - Region: 10-49
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0048
Family HLH, helix-loop-helix DNA-binding domain 0.0094
Further Details:      
 
Domain Number - Region: 493-555
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0288
Family Apolipoprotein A-I 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000311196
Sequence length 802
Comment NPAS4 (Homo_sapiens) neuronal PAS domain protein 4
Sequence
MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFAGGT
PLAGPTGLLSAQELEDIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIY
DIIDPADHLTVRQQLTLPSALDTDRLFRCRFNTSKSLRRQSAGNKLVLIRGRFHAHPPGA
YWAGNPVFTAFCAPLEPRPRPGPGPGPGPGPASLFLAMFQSRHAKDLALLDISESVLIYL
GFERSELLCKSWYGLLHPEDLAHASAQHYRLLAESGDIQAEMVVRLQSKRGSWAWIYCLL
YSEGPEGPITANNYPISDMEAWSLRQQLNSEDTQAAYVLGNPTVLPSFPETVLSQEQCSN
PLFTPALGAARSTSFSSAPQLGVVSTSEEIPQPLKELDFSYLPFPSGPEPSLQADLSKDL
VCTPPYTPHKPGGCTFLFSLHEPFQTHLPIPSSSFQEQLTPSTATFSDQLTPSSATFPDP
LTSPLQGQLTEISARNYEDQLTPCTSTFSDQLLPSTTPFPESLGSPTQEQLTPPTTAFQA
HLNSPSQTFPEQLSPNSTKTYFAQEGCSFLYEKLPPSPSSPGNGDCTLLALAQLRGPLSV
DVPLVPEGLLTPEASPVKQSFFHYSEKEQNEIDRLIQQISQLAQGMDRPFSAEAGTGGLE
SLGGLEPLDSNLSLPGAGPPVLSLDLKPWKCQELDFLANPDTIFPEETTVEDIFMDLSTP
DPNGEWGSGDPEAEGPRGASSHCNNLSPEDHSFLEDLATYETAFETSVSTFPYDGFPDEL
HQLQSQVQDSFHEDGSGGEPTF
Download sequence
Identical sequences G5BWY0
HGL_H00000311196 XP_004852363.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]