SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000311427 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000311427
Domain Number 1 Region: 211-339
Classification Level Classification E-value
Superfamily PX domain 2.49e-26
Family PX domain 0.0018
Further Details:      
 
Domain Number 2 Region: 5-72
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000021
Family SH3-domain 0.0018
Further Details:      
 
Weak hits

Sequence:  HGL_H00000311427
Domain Number - Region: 362-569
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00488
Family BAR domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000311427
Sequence length 571
Comment SNX33 (Homo_sapiens) sorting nexin 33
Sequence
MALKGRALYDFHSETEGEISIRQDEDLVVFSETSLDGWLQGQNSRGEMGLFPASYVEIIR
PGIGANHGDYPSSPAGSLGTQVSAYDSFSPARSGGGSGFFSNPGSFEEDDDDDWDDWDDG
CTVVEEPRGAGLGTNGHPPLNLSYPGAYPSQHMALRPKPPLERQDSLASAKRGSMVGRNL
NRFSCFVRSGVEAFILGDVPMMAKIAETYSIEMGPRGPQWKANPHPFACSVEDPTKQTKF
KGIKSYISYKLTPTHSGSPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFI
EKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEKDEMVGASFLLTLQ
IPTEHQDLQDVEDRVDTFKAFSKKMDDSVLQLSTVASELVRKHAGGFRKDFQKLGSAFQA
ISQAFQMDPPFSSEALNSAISHTGRTYETVGEMFAEQPKNDLFHMLDMLSLYQGLLSNFP
DIIHLQKGAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGFALQAEMSHFHQRRELDFQ
HMMQSYLRQQILFYQRVAQQLEKALRMYDHL
Download sequence
Identical sequences G5AL79
HGL_H00000311427 XP_004872113.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]