SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000311493 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000311493
Domain Number 1 Region: 400-575,608-703
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 3.14e-57
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.00039
Further Details:      
 
Domain Number 2 Region: 1118-1174
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.83e-20
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00011
Further Details:      
 
Domain Number 3 Region: 705-747
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000000000497
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000311493
Sequence length 1174
Comment STON1-GTF2A1L (Homo_sapiens) STON1-GTF2A1L readthrough
Sequence
MCSTNPSNWVTFDDDSAFQSQKSRHFPLENQGVCRPNGLKLNLPGLKEFPSGSSSTSSTP
LSSPIVDFYFSPGPPSNSPLSTPTKDFPGFPGIPKVGTHVLYPIPESSANTLVGAGFSLL
PAKPTCLSQAFLPSDLSCTVPAPKVGLPGELCPQQAENTGVQSDASQFQYFQEDCAFSSP
FWKEEGSGSQFTFDPSGSRKMFSPRDKGIPVDQKSLNKCSLNYICEKLEHLQSAENQDLL
GSVSMQCPYAEDSASSFVPHTLFRSQPKAGWSFMLRIPEKKNMMSSRQWGPIFLKVLPGG
ILQMYYEKGLEKPFKELQLNPHCRLSEPKVENFSVAGKIHTVKIEHVSYTEKRKYHSKTE
VVHEPDTEQMLKLGSLEYRDFLDFLITVEEELMKLPAFSKPKKNYEEQEISLEIVDNFWG
KVTKEDGKLVESAVITQICCLCFVNGNTECFLTLNDLELQKRDECCFEKDTEKKWIDILD
CHFHKCVKEQEFEQTRIIKFVPLDACRFELMRFKTLYHGDDLPFSVKSVVVVQGAYVELQ
AFVNMAPLVQRPSHAGSLRSCDNVMIHFPVPSQWIKALWTMNLQRQKSLKAKMNRPMCLG
NLHEPESEPVIQVTVGSAKYESAYQAVVWKIERLPDKNSSPDHPHCLSYKLELGSDQEIP
LDWYPFATVQFSMADTCASWAAVRSLGVESDVQPQKHIQQRACYSLQPKLYKSIIEDVIE
GVRDLFAEEGIEEHVLKDLKQLWETKVLQSKATEDFFGNGIHSPLFTFQLPHTLHQTLQS
TASLVIPAGITFPGFTTAELGTSNSSASFTFPGYPIHVPEGVTLQTASGHLYKVNVPIMV
TQASRRPSILQHPIQVFQQLGQPSVIQASVPQLNPSSVQATTEKSQRMEAMLQQPTILHS
GPVDRKHLENATRDVFVPPGNEHGVLSEALLSQQEGSQCVHVSGVVFPSQASPTGSSVEP
VLSVPARVTQNLLGGCLSAETQGTVHHQVTDTQPHFLKYCVYGGDSISQPGEIEEPNSLP
VSKKNSNSQVDLSNLLTDDDINEIIQVDGTGDTSSNKEIKNIRDVKNEFLGIIDGGDLKV
LEEVDSISNEDSTTNSSDNEDSQLDIVEEDPLNSGDDVSEQDVPDLFDTDNVIVCQYDKI
HRNKNKWKFYLKDGIMCFGGRDYVFAKAIGDAEW
Download sequence
Identical sequences G5ANC0
HGL_H00000311493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]