SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000311596-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000311596-1
Domain Number 1 Region: 135-179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000368
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Weak hits

Sequence:  HGL_H00000311596-1
Domain Number - Region: 1-28
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000131
Family KRAB domain (Kruppel-associated box) 0.0067
Further Details:      
 
Domain Number - Region: 69-112
Classification Level Classification E-value
Superfamily L35p-like 0.0497
Family Ribosomal protein L35p 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000311596-1
Sequence length 210
Comment ZNF699 (Homo_sapiens) zinc finger protein 699
Sequence
MLETFQNLVSLGYQVSIPHLISQWEQEEDLLKVKGGLIQGICMKEHQEGFETQLNTNELV
AFQDIDGEKTSREQKIRVKRTGSCSFILHENWESHGVDEQNKSHERHLSHMVENIYECNE
ENQCEQIPNLNVLKRTIEVKSYECRECGKAFMFHSSLKNHIRSHAGSKPYQCQECGKAFH
FLACFKKHIKTPTEEKPYEYINKYEDFERG
Download sequence
Identical sequences G5B346
HGL_H00000311596-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]