SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000311596-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000311596-2
Domain Number 1 Region: 186-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.7e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 4-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.28e-20
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 3 Region: 150-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.54e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 242-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.77e-18
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 5 Region: 80-137
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000103
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 6 Region: 287-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000212
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000311596-2
Sequence length 347
Comment ZNF699 (Homo_sapiens) zinc finger protein 699
Sequence
QKNMIQDSLTFEDLAVDFTPEEWALLDLAHRKLYRDVMLENFQNLTSLGFKILLKTNESV
VLPHNNLEKVSNEQKECGKAFHFLAYFKKHMKTPTEEKPYECKECAILFSCSSFFRAHMK
IHSGKINYECKECGKTFSNSYLTEHKRIVCECDECEKAFSCPSSLSQHKRIHSGDKPYEC
KECGKAFSSSSHLITHIRIHTGEKPYECKACGKAFSEPSKLNQHMRTHTGDKPYKCKDFG
KTYNCPSSLSIHMRKHTGEKPYECLECGKAFYLPTSLYTHVKNQSREKPYECKGCRKAIN
YPSSFKAHVRDHAQEIQYACKECVKLFSCSSSLTEHLRSHSGEKPYQ
Download sequence
Identical sequences G5BHE8
HGL_H00000311596-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]