SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000311596-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000311596-3
Domain Number 1 Region: 314-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.26e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 482-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.51e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 538-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.83e-23
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 5 Region: 14-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.28e-19
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 580-632
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 278-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-17
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 8 Region: 444-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 9 Region: 230-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000109
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 10 Region: 193-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000747
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000311596-3
Sequence length 641
Comment ZNF699 (Homo_sapiens) zinc finger protein 699
Sequence
MGEERRNAELQKNMIQDSLTFEDLAVDFSPEEWALLDLAQRKLYRDVMLETFRNLASLVL
CALPIHPSLSLNPLSATDFVLSLVILPCTGCCIVGIRSSGFKILLKTNESVVLPDNNLEK
VSNEQKVIRFNRNGSWFSILHANWEHYGIDEKNKSHGRLLSHMVENVYECNEENQSEQIP
NLNVLKRTTEVNSYECHECGKAFLCHSSLKNHIRSHTRSKPYQCQECGKTFHFLAYFKKH
MKTPTEEKPYECKECAILFSCSSFFRAHMKIHSGKVNYECKECGKTFSTSSYLTEHKRIH
SGDKPCECDECGKAFSCPSSLSQHKRIHSGDKPYECKECGKAFSSSSHLITHIRIHTGEK
PYECKECGKAFSESSKLSRHMRAHTGEKPYKCKDCGKTYNCPSSLSIHMRKHTGEKPYEC
LECGKAFYLPTSLYTHVKNQSREKPYECKQCGKAFSCPSSFKAHVRDHAREIQYQCKECG
KVFSRSSSLTEHLRTHSGEKPYQCKECGKAFISSSQLTVHRRTHTGEKPYECKNCEKSFM
YFSAFSFHMRMHTGEKPYECKECGKAFRHSSYLTIHARMHTGEKPFECLECGKAFRCPSS
FQRHVKSHTGEKPYECKECGKAFICAAYLRRHVKIHNRGKI
Download sequence
Identical sequences G5BVV3
HGL_H00000311596-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]