SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000311679 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000311679
Domain Number 1 Region: 382-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.99e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 493-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 437-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.79e-21
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 4 Region: 535-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-16
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 5 Region: 344-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000123
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 6 Region: 34-79
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000051
Family KRAB domain (Kruppel-associated box) 0.0032
Further Details:      
 
Domain Number 7 Region: 299-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000224
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Weak hits

Sequence:  HGL_H00000311679
Domain Number - Region: 183-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0025
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number - Region: 224-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0175
Family Classic zinc finger, C2H2 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000311679
Sequence length 594
Comment ZNF483 (Homo_sapiens) zinc finger protein 483
Sequence
MKWGGVDPGAQDSAVYQEDNSEEDKLVPNTESCESIVFKDVAITFSRREWRKLEPFQKEL
YKDVLQENLRNLEFLECEPKGELEVSVQNCNVFMEDLTLEKIIEECFKDDGCGLIAEFRK
HYGKSKEDHDKQGHSKGSVIQKKTHRIDNKGEVLDPEKSPNGQKLKWTSDKAKHLKAYLK
KCRKFNECKKPFSFHSDLVLNRRENTAEKSEKHSEAGKDLNSSSSLPEHQKCKKIHLGAK
SPNCGKCGVAFTQISSHSKIKNSTCVKCQKKLKDATSNKDEGTKTGETTHKCSKCGKIFC
FSAPPSKYHRIHTVEKPSMCPECRKAHSGSSSLKAHYKNQNVEKPHKCDDCGKGITLANV
TKHQRIHSGEKPFQCKDCGRPFSDSSSLYQHQRIHTGEKPYKCKDCGKSFSHSSSLSKHQ
RIHTGEKPYTCDECGKSFRQASCLKRHERIHTGERPYLCNDCGATFSHFSTLHYHQRLHR
GEKPYKCDRCEKAFSAHSLLSRHMRSHTGVKPYKCKDCGKTFSQSSSLNEHYRTHTGEKP
YECDFCGATFTRSTILVEHVKIHTRTSDHECNECDKKFKSISSLIRHRASHTKK
Download sequence
Identical sequences G5ALL6
HGL_H00000311679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]