SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000312042 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000312042
Domain Number 1 Region: 437-535
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.39e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000215
Further Details:      
 
Domain Number 2 Region: 579-652
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.94e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 3 Region: 1047-1122
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.55e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000928
Further Details:      
 
Domain Number 4 Region: 646-722
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000985
Further Details:      
 
Domain Number 5 Region: 345-432
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000432
Further Details:      
 
Domain Number 6 Region: 147-218
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000132
Further Details:      
 
Domain Number 7 Region: 969-1045
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.36e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000938
Further Details:      
 
Domain Number 8 Region: 1117-1198
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.33e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000679
Further Details:      
 
Domain Number 9 Region: 723-805
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.21e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 10 Region: 866-918,945-968
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000175
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 11 Region: 290-365
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000643
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 12 Region: 794-876
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000497
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 13 Region: 218-291
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000657
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Weak hits

Sequence:  HGL_H00000312042
Domain Number - Region: 100-148
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0501
Family Eukaryotic type KH-domain (KH-domain type I) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000312042
Sequence length 1265
Comment HDLBP (Homo_sapiens) high density lipoprotein binding protein
Sequence
MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEKAACLESAQEP
TGAWNNKIRPIKASVITQVFHVPLEERKYKDMNQFGEGEQAKICLEIMQRTGAHLELSLA
KDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVPIPKEHHRFVIGKNGEKLQDLELKT
ATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFIAGP
YNRLVGEIMQETGTRINIPPPSVSRTEIVFTGEKEQLAQAVARIKKIYEEKKKKTTTIAV
EVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSTSETVILRGEPEKLGQALTEVYAK
ANSFTVSSVSAPSWLHRFIIGKKGQNLARITQQMPKVHIEFTEGEDKITLEGPTEDVNVA
QEQIESMVKDLINRMDYVEINIDHRFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSDL
IRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEV
IINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVAELVENSYSISVPIFKQFHKNIIGKG
GANIKKIREESNTKIDLPAENSNSETIVITGKRANCEAARSRILSIQKDLANIAEVEVCI
PAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSLDVEKAKKQLLHLA
EEKQTKSFTVDIRAKPEYHRFLIGKGGGKIRKVRDSTGARIIFPAAEDKDQDLITIIGKE
DAVREAQRELEALIQNLDNVVEDCMLVDSRHHRHFVIRRGQVLREIAEEYGGVMVSFPRS
GTQSDRVTLKGAKDCVEAAKKRIREIIEDLEAQVTVECAIPQKFHRSVMGPKGSRIQQIT
RDYNVQIKFPDREEAPAHGMEPAIQENGDEAGEGREADPGSPRRCDIITISGRKEKCEAA
REALEALVPVTIEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIHVPAPELQSDVIAITGL
ATNLDRAKAGLLERVKELQAEQEDRALRSFKLNVTVDPKYHPKIIGRKGAVITQIRLEHD
VNIQFPDKDDGSQPQDQITITGYEKNTEAARDAILKIVGELEQMVSEDVPLDHRVHARII
GARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEYLADVVD
SEALQGHMKPPAHGEVKAPSKGFVVRDAPWTASSSEKAPDMSSSEEFPSFGAQVAPKTLP
WGPKR
Download sequence
Identical sequences G5C3R6
XP_004868537.1.39548 XP_012922354.1.39548 XP_012922355.1.39548 XP_012922356.1.39548 HGL_H00000312042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]