SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000312129 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000312129
Domain Number 1 Region: 145-386
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-49
Family Voltage-gated potassium channels 0.0016
Further Details:      
 
Domain Number 2 Region: 62-129
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000204
Family Tetramerization domain of potassium channels 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000312129
Sequence length 439
Comment KCNG4 (Homo_sapiens) potassium voltage-gated channel, subfamily G, member 4
Sequence
MPTPSRYRNPKPGHHPYGSCSPLSQFLHSPLEPRVVKGLYYRRARRVGAPDASPATDLKK
EILVNVGGQRYLLPWTTLDAFPLSRLSRLRLCRSHEEIAQLCDDYAADRQEFFFDRSPSA
FGVIASFLAXCMNRLRQMVDDPQSGLPGKVFACLSILFVATTAVSLCVSTMPDLRAEEDK
GECSQKCYYIFIVETICVAWFSLEFCLRFVQARNKCRFFQGPLNIIDILAISPYYVSLVV
SEEPPEDGERPNGSSYLEKVGLVLRVLRALRILYVMRLARHSLGLQTLGLTVRRCTREFG
LLLLFLAVAVTLFSPLVYVAENESGRVLEFTSIPASYWWAIISMTTVGYGDMVPRSVPGQ
MVALSSILSGILIMAFPATSIFHTFSHSYLELKRAQERLQARLCHLQSAHAASTSERELL
ADVDDLVSSEGPALPAAYL
Download sequence
Identical sequences G5BFY5
HGL_H00000312129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]