SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000312675 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000312675
Domain Number 1 Region: 266-346
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.03e-16
Family Canonical RBD 0.0000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000312675
Sequence length 649
Comment TRIM72 (Homo_sapiens) tripartite motif-containing 72
Sequence
MASNGSYGAYPTQPGQGYSQQSNQPYGQQSYSSYGQSADTSGYGQSSYSSSYGQSQNTGY
GTQSAPQGYGSTGGYGSGQSSQSSYGQQSSYPGYGQQPTPSSTSGSYGSSSQSSSYGQPQ
SGGYGQQSGYSGQQQNYGQQQSSYNPPQGYGQQNQYNSGSGGGGGGGGSYGQDQSSMSGG
GGGYGSQDQSGAGSGGYGGGAGPCGGRGRGGGGGYSRSSGGYEPRGRGGGRGGRGGMGAF
TAAAVVAMNPEVAEVAVEAEAAWEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTN
KKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGGNYGDDRRGGRGGYDRGG
YRGRGGDRGGFRGGRGGGDRGGFGPGKMDSSRCAGAVLRPLPCDLELRKPVRWRVPAAHC
TLCASSSNCWGRPLVKVAFMGKQLNISARSDDSRRTQLPQQKTQLQEACERKEKSVGLLQ
HQLVEVEETVRQFRGAVGEQLGKMRLFLAALEGSLDREAERVRGEAGAALQRELAGLNSY
LEQLREMEQVLEEVADKPQTEFLMEFSVQLQCEEMLEASFPSGPILCGEGKDTSLHLRTP
RLQKILAESPPPARLDIQLPVISDDFKFQVWRKMFRALMPAPNPHMGDF
Download sequence
Identical sequences G5BYC2
HGL_H00000312675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]