SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000312814 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000312814
Domain Number 1 Region: 72-175
Classification Level Classification E-value
Superfamily POZ domain 1.18e-29
Family Tetramerization domain of potassium channels 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000312814
Sequence length 263
Comment KCTD2 (Homo_sapiens) potassium channel tetramerisation domain containing 2
Sequence
MAELQLDPAMAGLGGGGGSGLSDGGGLGRGTLSPRPAVPLPRGHGRQPAAVAQPLEPGPG
PPERAGGGGAARWVRLNVGGTYFVTTRQTLGREPKSFLCRLCCQEDPELDSDKDETGAYL
IDRDPTYFGPILNYLRHGKLIITKELAEEGVLEEAEFYNIASLVRLVKERIRDNENRTSQ
GPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLISIGSSYNYGNEDQAEFLCVVSRELNN
STNGIVIEPSEKAKILQERGSRM
Download sequence
Identical sequences G5BND1
XP_004860685.1.39548 HGL_H00000312814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]