SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000312988 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000312988
Domain Number 1 Region: 52-304
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.58e-134
Family Ankyrin repeat 0.0000000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000312988
Sequence length 360
Comment NFKBIB (Homo_sapiens) nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta
Sequence
MAGVACLGKATDADEWCDSGLGSLGPDAAAPGGSGLCAELGPGLSWAPLVFGYVTEDGDT
ALHLAVIHQHEPFLDFLLGFSAGTEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGL
LVGERGGHTALHLACRVRASACARVLLQPRPQEAPCSYLTQSRDRTCDTSHNPAALHPEP
ELEKEEEESEEDWKLQLEAENYEGHTPLHVAVIHKDAEMVRVLRDAGADLNKPEPTCGRS
PVHLAVEAQAADVLELLLRAGANPTARMYGGRTPLGSALLRPNADLAHLLRAHGAPEPED
EDEKPGPCSSSSDSDSDSDDSDSRDEGDEYDDIVVHSGRSPSRLPPAPASTPLPDDPGPI
Download sequence
Identical sequences G5AMA1
XP_004859140.1.39548 HGL_H00000312988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]