SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000313025 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000313025
Domain Number 1 Region: 253-337
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000654
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 2 Region: 801-1007
Classification Level Classification E-value
Superfamily TPR-like 0.00000000228
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 
Domain Number 3 Region: 1036-1173
Classification Level Classification E-value
Superfamily TPR-like 0.0000000039
Family Tetratricopeptide repeat (TPR) 0.055
Further Details:      
 
Domain Number 4 Region: 199-259
Classification Level Classification E-value
Superfamily SH3-domain 0.00000116
Family SH3-domain 0.0067
Further Details:      
 
Domain Number 5 Region: 1186-1288
Classification Level Classification E-value
Superfamily TPR-like 0.00000778
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 
Domain Number 6 Region: 537-669
Classification Level Classification E-value
Superfamily TPR-like 0.0000813
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000313025
Sequence length 1336
Comment SH3TC2 (Homo_sapiens) SH3 domain and tetratricopeptide repeats 2
Sequence
MGGCFCIPGERSLSWGPGKEGPSEDPTISSECISSSESRGKCFLPQNMTPDLTLTFCVKS
RSRRCVNGALQEAARRRLWTLENEDQDARALFKDLSARLVNIQSQRAQFLITFKTMEEIW
KFSTYLDLGITWVEHAGYVSTCLEHLLFDHKYWLNCRLVEDTEIQVSVDDKHLETMYLGL
LIQEGHFFCRAMCSVAQPAEKEGECLELCKNELISVKISEGESEWEGVSLVTGQRGLVPV
SALEPLPVPFHQWFLKNYPGSCGLSRKRDWTGSYQIGRGRCKASKDYEQEEKDELSFCQG
ESIEIIGFVIPGLQWFIGKSVFSGAVGFVPTRNIDPDSYCPMSRNSAFYSDEERCSLWAL
GSDRKADCASFLRTLAHTDIASVYRLSGFESIQNLPNDLSATQPEGFKEARPGTARKEHQ
AVGSRWSSSSENSSLEEELLSAASDSYHLPDPDDLDDPELFMDLNTGQDEEEAENFAPLL
GFLDHEGYTDHFKSLYDFSFSFLTTSPFYCFSEEDELMAYLEASRKWAKRSHMTWAHARL
CFLLGRLSVRKVKLSQARVYFEEAIHILQGAFEDLSLVSALYINLAAIYLRQRLRHKGPA
LLEKAGALLACLPDREFSAKNELDVVAYVLRQGIVVGSSPLEARACFLAVRLLLSLGRHE
EVLPFAERLQLLSRHPPASDATATILSFLYDKKYLPCLAVASVQQCGTHSAHGMSLLIWQ
VCLVLQNTTKLLGMSSPSWGEVSALACPTLRQALAACEEQIDWSTQRALCLILSKMYLQY
RSPDGAIYYLWGKVSALACPTLRQALAACEEQIDWSTQRALCLILSKMYLQYRSPDGAIY
YLSQALVLGQLLGEQEAFESSLCLAWGYLLASQAKKALEILEPLLCSLKETESVTQRGVV
HNLLGLALQDQGRVSGAARSYLRALNRAQETGDVHNQAVTMANLGHLTLKAQQPAKDYLL
QAVRLYSELQASKDTDMELVQVLLWLAQVLVSGRQLTQGQLCYEMALLFGLRHRHLKSQL
QVTKFLCHFYSSVSPNPEACITYHEHWLALAQQLRDREMEGSLLESLGQLYRNLNTARSL
RRSLTCIKESLRIFIDLGERDKAAAAWLGAGRLHYLLQEDELVELYFQAAIQTALKSQEP
SLALRLYEEAGDVFFNGTRHRHRAVEYYRAGAVPLARRMKALRTELRIFNKLTELQISLE
GYEKALEFAMLAARLSRVTGDQKQKLVAFHRLATVYYSLHMYEMAEDCYSPEEALYYAKV
YYRLGRLTFYQLKDAHDATEYFLLALAAAVLLGDEELRDIIRRRLDNICQSPLWHSSPSG
CSSERARWLSIGGLDL
Download sequence
Identical sequences G5B2D2
HGL_H00000313025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]