SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000313355 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000313355
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.07e-22
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 2 Region: 285-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-19
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 327-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.07e-17
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 4 Region: 233-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000502
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Weak hits

Sequence:  HGL_H00000313355
Domain Number - Region: 190-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00094
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000313355
Sequence length 391
Comment ZNF713 (Homo_sapiens) zinc finger protein 713
Sequence
QESLTFQDVAVDFTKEEEEQLYPAQKNLYRDVMLENYRNLVALGHQVYKPAVITQLEQEE
LWTRGGGHPVGAPLDGDNGPKIKKSTLNQNISDKNQTCDIIMERLTGDSFWYSILGGLWD
LDYQFAFNQENQQRHLGQISFIHQKITQGRSIKGNKFEENYKKNSNLIHQRVPSIKTPLN
YDTPANSIKHNSDLIYYQGNYVRENPYEYHERGKIFSQHVLTNHIHTGENPGECGKGFSH
NLSHIQPQIVLTGEKPYKCDECGKRFSQRIHLIQHQRIHTGEXIHTGEKPYKCNQCGKAF
SRITSLTEHHRLHTGEKPYECSFCRKAFSQRTHLNQHERTHTGEKPYKCNACGKAFSQSA
HLNQHKKIHAREKLCDYTCKKTLSHQPSLSS
Download sequence
Identical sequences G5ASR9
HGL_H00000313355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]