SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000313582 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000313582
Domain Number 1 Region: 230-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.93e-26
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 2 Region: 175-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 399-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 343-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.41e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 287-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.92e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 7-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.11e-21
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 7 Region: 122-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.9e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000313582
Sequence length 470
Comment ZNF436 (Homo_sapiens) zinc finger protein 436
Sequence
MAATLLMAGSQGPVTFEDMAMYLTREEWRPLDPTQRDLYRDVMQENYGNVVSLDFEIRSE
NEVNPKQEISEDVEFGTTSEGPGGNVEENPESEETFESRDRSERQWGDLTAEEWVSYPLQ
QVTDLLVHKEAHTGIQYHICSHCGKAFSQISDLNRHQKTHTGDRPYKCYECGKGFSRSSH
LIQHQRTHTGERPYDCNECGKSFGRSSHLIQHQTIHTGEKPHKCNECGKSFCRLSHLIQH
QRTHSGEKPYECEECGKSFSRSSHLAQHQRTHTGEKPYECNECGRGFSERSDLIKHYRVH
TGERPYKCDECGKNFSQNSDLVRHRRAHTGEKPYHCNECGENFSRISHLVQHQRTHTGEK
PYECNACGKSFSRSSHLITHQKIHTGEKPYECNECWRSFGERSDLIKHQRTHTGEKPYEC
VQCGKGFTQSSNLITHQRVHTGEKPYECSECEKSFSRSSALIKHKRVHTD
Download sequence
Identical sequences G5BHZ0
XP_004850607.1.39548 XP_004850608.1.39548 XP_012929860.1.39548 HGL_H00000313582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]