SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000313601 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000313601
Domain Number 1 Region: 647-772
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000606
Family Synaptotagmin-like (S variant) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000313601
Sequence length 948
Comment CC2D1A (Homo_sapiens) coiled-coil and C2 domain containing 1A
Sequence
MHKRKGPPGPPGRGAAAARQLGLLVDFSPDGLMIPEDGVNNEELEAEFLTLVGSQPAALG
KLKGKGPLPMEAIEKMARLCMQDPDEEEEEGTDEDDIEADDDLLAELNEVLGAEQKASDP
PPPMAQPKPSAPHPGLEATLQERLTLYQLAMESAQQAGDSAKMRRYDRGLKTLENLLASV
QKGNTINEEDIPPPVAVGKGPATSHNPEPPPPSPANLPASDPRANLEGSLSATPASSLGS
AKPQLAPGPCGSGLLAQLQSRQRDYKLAALHAKQQGDTVAATRHFRVAKSFDAVLEALSR
GEPVDLSCLPPPPDQLTPELPSQTLQPPALPTAPAMPEVPPAPRTFLEALEQRMERYQVA
AAQAKAKGDQRKARMHERIVKQYQDAIRAHKAGRAVEVAELPVPPGFPPIQGLEAPEATQ
QSLVGVLETAMKLANQDEGPEDDDDDEASKKLNSPAAPTAQAKALPSRAPHTGAAPAAKA
APKGTSTRAQQQLAFLEGRKKQLLQAALHAKQKNDVEGAKMHLRQAKGLEPMLEASRNGL
PVDIAKVPPAPINKDDFALVQRPGPGLSQEAARRYGELTKLLRQQHEMCLNHSNQFTHLG
NISETSKFEKLAEDCRRSMDTLKQAFTRGLPTPVARFEQRTFSVIKIFPELSSNDMLLFI
VKGINLPTPPGLSPGDLDVFVRFDFPYPNVEEAQKDKTSVIKNTDSPEFKEQFKLCISRS
HRGFRRALQTKGIKFEVVHKGGLFKTDRVLGTAQLKLDMLETACEVHEILEVLDGRRPTG
GRLEVMVRIREPLTAQQLETTTERWLVIDPLPAAVPTQVAAPKGKGPPMPAPSREAGNRS
ARPLHSLSVLAFDQERLERKILALRQARRPVPPEVAQQYQDVVQRSQWQRAQLEQGGAGI
RREYTAQLERQLQFYTEAARRLGNDGSREAAKEALYRRNLVESEVSCL
Download sequence
Identical sequences G5BYU4
HGL_H00000313601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]