SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000313877 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000313877
Domain Number 1 Region: 99-207
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 1.8e-23
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000171
Further Details:      
 
Domain Number 2 Region: 201-317
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 2.22e-22
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000302
Further Details:      
 
Domain Number 3 Region: 46-97
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000291
Family TS-N domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000313877
Sequence length 325
Comment TSFM (Homo_sapiens) Ts translation elongation factor, mitochondrial
Sequence
MSLLRSLRLCLVTRTGSHPAGSLLLQSAQPWRTFQAGPWLSSSASSKELLMNLRRKTGYS
FVNCKKALETCGGDLKQAEIWLQKQAQKEGWSKAAKLHGRKTKEGLIGLLQEGNMAVLVE
VNCETDFVSRNLKFQELVQQVALGTMLYCQNLKDQLSTYSKAFLNSSELSGLPAGPDRDG
SLKDQLALAIGKLGENMTLKRAAWVKVPSGFYIGSYIHGAVHSPSFNNLELGKYGALVIC
ETSEPKATLEDVGRHLGQHVVGMAPLSVGSLDDEPGGETETKMLSQPYLLDPSITLGQYV
QPRGVSVVDFVRFECGEIEEATEAQ
Download sequence
Identical sequences G5BEB3
HGL_H00000313877 XP_004861225.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]