SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000314032 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000314032
Domain Number 1 Region: 15-210
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.15e-51
Family Motor proteins 0.00025
Further Details:      
 
Domain Number 2 Region: 459-517
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000239
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0038
Further Details:      
 
Domain Number 3 Region: 529-590
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000000000432
Family BCR-homology GTPase activation domain (BH-domain) 0.0026
Further Details:      
 
Domain Number 4 Region: 209-256
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000172
Family Motor proteins 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000314032
Sequence length 749
Comment MYO9B (Homo_sapiens) myosin IXB
Sequence
NLLDRASLKLIISMTLHDRTTRSLLHLHKKKKPPSISAQFQTSLNKLLETLGKAEPFFIR
CIRSNAEKKELCFDDELVLQQLRYTGMLETVRIRRSGYSAKYTFQDFTEQFQVLLPKDAP
PCREVISALLEKMRVHQRSYQIGKTKVFLKETERQALQETLHREVMRKILLLQSWFRMVL
ERRHFLQMRRAAVTIQACWRSYQVRRALERTQAAVCLQAVWRGYRQRKAYCRQRRSVIRL
QSLCRGHLQRRSFSQMLGEKQKEXXEAQEAARGQDTEPGPGPEAAEEQVAGQGVGAAGDS
EHLAPAPEPQPEERSPAEEEAAPPPGKGLQTPRSTAXERRISLSTGDVSKLSPAKPQIND
LRSQKTPIESLFIEATERFRSNIKTMYSVPNGKIHVGYKDLMENYQIIVNNLASDPGEDT
NLVLNVFQSLLDEFTRRCAKNDFEPVKPSKAQKKKRKQERAVQEHNGHVFASYQVSIPQS
CEHCLSYIWLMDKALLCSVCKMTCHKKCVHKIQSYCSYLSGRKSEPGAEPGHFGVCVDSL
TSDKTSVPLVLEKLLEHVELHGLYTEGLYRKSGAANRTRELRQALQTGGWGWRQPQPPLW
AQEAGLPWPFKLGFSSPCEGVLSKSPKTPVSRDSSLEELEALPEEEAAAARGHENREKEI
LMERIQSLKEEKQVSHLPTREPAGPVRRREPPARRPDQVRSVYIAPCRGLPTPGALEPLD
KDARPRGAKRRYSDPPTYCLPPAPGQAPG
Download sequence
Identical sequences HGL_H00000314032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]