SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000314103 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000314103
Domain Number 1 Region: 7-133
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-26
Family Ankyrin repeat 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000314103
Sequence length 494
Comment ANKRD34A (Homo_sapiens) ankyrin repeat domain 34A
Sequence
MLHTEGHALLRAVGQGKLRLARLLLEGGAYVNEGDAQGETALMAACRARYDDPQNKARMV
RYLLEQGADPNIADRLGRTALMHACAGGGGAAVASLLLAHGADPSVRDHAGASALVHALD
RGDRETLATLLDACKAKGTEVIIITTDTSPSGTKKTRQYLNSPPSPGVEDPAPAPLSPGV
CTSPSEIQLQNAGGLGSLSPRAQEEEEKRDVFEFPLPKPPDDPAPPEPLPKPPRHPPKPL
KRLNSEPWGLVAPPQPVPPAEGRPGIERLTAEFNGLTLTGRPRLSRRHSTEGPEDPPPWA
EKVTGGGPLSRRNTAPEAQESGLPSGLRQKLSRMEPVELDIPGHLCPDSPESSRLSLERR
RYSASPLTLPPAGSAPSPRQSQESLPGAVSPLSGRRRSPGLLERRGSGTLLLDHISQTRP
GFLPPLNISPHPPIPDIRPQPGARAPSLPAPPHAAGPGSPRTKRKLVRRHSMQTEQIRLL
GGFQSLGGPGEAGR
Download sequence
Identical sequences G5BBN2
HGL_H00000314103 XP_004853978.1.39548 XP_004853979.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]