SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000314518 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000314518
Domain Number - Region: 69-103
Classification Level Classification E-value
Superfamily LysM domain 0.00034
Family LysM domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000314518
Sequence length 306
Comment LYSMD3 (Homo_sapiens) LysM, putative peptidoglycan-binding, domain containing 3
Sequence
MAGRHQNHSFPLPGVQSSGQVHAFGNCTDSDILEEDAEVYELRSRGKERVRRSTSRDRLD
DIILLTKDIQEGDTLNAVALQYCCTVADIKRVNNLISDQDFFALRAIKIPVKKFSSLTES
LYAPKGRQASRPSAVQYAPEQQEILPANDCLSSNESAGSFLKEVDRDIEQIVKCTDTKKE
NLNEVVSALTSQQIRFEPDNKNTKLKDPYYGADWGIGWWTAVVIMLIVGIITPVFYLLYY
EILAKVDVSHHSTVDSSHLHSEITPSSQYREMENGIAPTRGIHVGQQDGHRLYGEDPQPA
AARHKT
Download sequence
Identical sequences G5BBF5
HGL_H00000314518 XP_004841734.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]