SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000314556 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000314556
Domain Number 1 Region: 9-227
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.94e-54
Family Ankyrin repeat 0.00024
Further Details:      
 
Domain Number 2 Region: 780-954
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000543
Family Tropomyosin 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000314556
Sequence length 1389
Comment UACA (Homo_sapiens) uveal autoantigen with coiled-coil domains and ankyrin repeats
Sequence
HAADWNKYDDRLMKAAERGDVEKVSSILAKKGVNPGKLDVEGRSAFHVVASKGNLECLNA
ILIHGIDITTSDSVGRNALHLAAKYGHALCLQKLLQYNCPTEHVDLHGRTALHDAAMADC
PSSIQLLCDHGASVNAKDIDGRTPLVLATQMCRPTICQLLIDRGADINSRDKQNRTALML
GCEYGCRDAVEILIKNGADASLLDALGHDSSYYARIGDNLDILALLKTAMENTSKGRELW
KKGPSLQQRHLAHVQDEVNMKSSQREHQNIQDLEVENEDLKDRLRKIQQEQRILLDKVNG
LQLQLNEEVMVADDLESEREKLKSLLATKEKQHEESLRTIEALKNRFKYFESDHLGSGGH
FSNRKEDVLKQSQMYVMESQCASPGMPVHMQSRSMLRPLEVSLPSQTSHSENEILKKEIE
AMRAFCDSAKQDRIKLQNELAHKVAECKALALECERVKEDSDEQIKQLEDALKDVQKRMY
ESEGKVKQMQTHFLALKEHLTSEAATGNHRVVEELKDQLKDMKTKYEGASAEVGKLRNQI
KQNEMLIEEFKRDESRLVEENKRLQKEFSMCEMEQEKKGRKVTEIEGQLKELLAKVALSI
PTEKFENMKSLLSNEVNEKAKKLVEMEREHERSLSEIRQLKRELENVRAKLAQQVSPEEH
EQLKARLEQKSGELGRKVTELMLKNQTLQKEIEKVHLDNKLLNQQVHNLTMEMKNHYVPL
KVSEEMKKSHDINIDDLNKKLSDATQKYTEKKFEVEKLLMENDRLSKNINRLETVFIPPE
KHEKEIMALKSNIVELKKQLSELNKKCGEDQEKIHALMSENTNLKKTLSNQYVPAKTHEE
TKTALNNTLDKTNRELSDAKKRFEDINQEFVKIKDENEILKRNLETTQNQIKTEYISLAE
HEGKMSVVSQSLKEVQEAKAAVLANYNQGQEEIVSLHAEIKAQKKELDTIHECIKLKYAP
IISFEECEQKFKATEKELKEKLSEQTQKCSVREEEAKKSKQESDKLKRDIITLQKELKDK
NLMEENSREMERVLSRKTEELNKQLKDLSQKYSEVKANKEKLAEEKAKQTSEILAAQNLL
QKQHVSLEQVEALKKSLHGTIENLKEELKNKQRCFEKEQQTVIKLQQLLENQKNSSVPLA
EHLQVKEAFEKEVGVMKASLREKEKESQNKTQEVSKLQTEVQNTKQALKKLETREVIDLS
KYKATKNDLETQVSNLNEKLANLNRKYDEVCEEVLHAKKKNFSGKDEKELLHFSIEQEIK
DQKERCDKSLTTITELQRRIQESAKQIEAKDNKITELLNDVERLKQALNGLSQLTYTSSS
PTKRQSQLVDALQHQVKALQQQLADADRQHQEVIAIYRTHLLSAAQGHMDEDVQAALLQI
IQMRQGLVC
Download sequence
Identical sequences G5C6T7
HGL_H00000314556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]