SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000314608 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000314608
Domain Number 1 Region: 211-398
Classification Level Classification E-value
Superfamily Kelch motif 1.96e-28
Family Kelch motif 0.0018
Further Details:      
 
Domain Number 2 Region: 446-511
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000131
Family Kelch motif 0.018
Further Details:      
 
Domain Number 3 Region: 9-60
Classification Level Classification E-value
Superfamily POZ domain 0.00000000141
Family BTB/POZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000314608
Sequence length 716
Comment KLHL11 (Homo_sapiens) kelch-like 11 (Drosophila)
Sequence
MRKWSSEPGPEPDTVEAVIEYMYTGRIRVSTGSVHEVLELADRFLLIRLKEFCGEFLKKK
LHLSNCVAIHSLAHMYTLSQLALKAADMIRRNFHKVIQDEEFYTLPFHLIRDWLSDLEIT
VDSEEVLFETVLKWVQRSAEERERYFEELFTLLRLSQMKPTYLTRHVKPERLVASNEVCV
KLVADAVERHALRAENLQSVSLLPRYGQNMDVIMVIGGVSEGGDYLSECVGYFVDEDRWV
NLPHIHNHLDGHAVAVTESYVYVAGSMEPGFAKTVERYSPSLNTWEHVCSLMTRKHSFGL
TEVRGKLYSIGGHGNFSPGFKDVTVYNPEVDKWHNLESAPKILRDAKALAVEDRFVYIAA
RTPVDRDTEDGLKAVITCYDTETRQWQDVDSLPLIDNYCCFQMSVASSSFYQTASCCPKS
YAMENAEAMSKIAGHAPDEILESLPPEVLSIEGAAVCYLRDDVFIIGGWKNSDDIDKQYR
KEAYRYCAERKRWLLLPPMPQPRCRATACHVRIPYRYLHGSQRYPMPQNLMWQKDRIRQM
QEIHRHALNMRRAANTQPCCMIRRQKEEGHSQKPQLSFTERPADVSSQVCSLLTYCPHPG
QGLSANLSVQLAGTDSQSEPGACVLILPHTVKALQVLSCEGSCVGEAVEDAAVGCTCRPA
LPCPALPLSHWGRSMSLLQCGLQKGLGFSSVTRARLRSRPWLQQVQLSSPNGECQS
Download sequence
Identical sequences G5B0L5
HGL_H00000314608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]