SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000315664 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000315664
Domain Number 1 Region: 36-123
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.19e-36
Family SCAN domain 0.0000545
Further Details:      
 
Domain Number 2 Region: 445-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.43e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 3 Region: 487-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 409-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000202
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 223-267
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000017
Family KRAB domain (Kruppel-associated box) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000315664
Sequence length 549
Comment ZNF18 (Homo_sapiens) zinc finger protein 18
Sequence
MPTDLGPALGLLPSPAKNDDCAFSGSDAAPPGELSSPETARQLFRQFRYQAISGPHETLR
QLRKLCFQWLRPEVHTKEQILEILMLEQFLTILPGEIQMWVRKQCPGSGEEAVTLVESLK
GDPRRLWQWISIQVLGQEILSEKKEFPSSPVGEVEPHVEVAPLEVGLQNSPSGSGELLSH
IVKEESDTEPELALATSKVPAQHEDRGIREQDFGAALLSAAPQEQWRHLDSTQKEQYWDL
MLETYGKMVSGAGISNSKPNLTNSAECGEDPAGLHLHVGEKIPRLSCVGDRQENDKENLN
LENHRDQEPLDASCQVSGEAPPQASLRGFFTEDDPGRFGEGENLPESLENLHGEGAAEQL
SPHERNSGKQLGQYMPNPPPEELSAVWLEEKREASQKGQPRAPMAQKFPTCRDCGKTFYR
ISQLVFHQRTHTGETYFQCPICKKAFLRSSDFVKHQRTHTGEKPCKCDYCGKGFSDFSGL
RHHEKIHTGEKPYKCPICEKSFIQRSNFNRHQRVHTGEKPYKCSHCGKSFSWSSSLDKHQ
RSHLGKKPF
Download sequence
Identical sequences G5B2C2
HGL_H00000315664 XP_004857607.1.39548 XP_004857608.1.39548 XP_004857609.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]