SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000316030 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000316030
Domain Number 1 Region: 475-599
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.6e-18
Family Protein kinases, catalytic subunit 0.0000749
Further Details:      
 
Domain Number 2 Region: 2-93
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000422
Family Laminin G-like module 0.044
Further Details:      
 
Domain Number 3 Region: 363-421
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.019
Further Details:      
 
Domain Number 4 Region: 268-337
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000746
Family PB1 domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000316030
Sequence length 1307
Comment COL19A1 (Homo_sapiens) collagen, type XIX, alpha 1
Sequence
MPQISIVVDGTKKVVEFMFQASEGDVLNYVFKNRELRPLFDRQWHKLGIDVQSRAISLYM
DCNLTASRQTDEKDPVDFQGRTVIAARASDGKPVDCPDQDIFGNLASSSVTAHAGEMSAY
LPAEPELPDLCPCVPSKGEAGLPGAAGSPGQKGEKREQGEHGLPGAPGLPGQKGEQGFEG
IQGKIGEKGEQGAKGDPGLPGLKGQDGVKGDLGPHGPPGPKGEKGDTGPPGPLALTPSPK
LTWPETVNSEHAELLLHFERPQPQDPRDIKTSSLENSIPFEGLCDKDRDVWCLVNKQLIT
THWVEEAGDPYTASPQLELEEAIRLSELKKDSELLIYSSPCIPEYPKVPCPGEEKSMCNR
AAGCWRKLYYATGHTFQAKRVSRRAHCAVCIDRVGGLGCQVYKCTNCKHSVHKKCHKLVT
IEYGQHFLTSEPMMPVNPSSVASDPAHTVIPHNLSTHEALEQVDEEHEEGLQPGDMTRTF
CGTPNFVAPEFIRGEDYSFSVDWWNLGVIIYIMMIRESPFDLNKSSDNPYENSIKGFADV
QEYPFFQNVDWDMMQQKQVVPPFKPIISEGFGLDNFDPEFTNELVQLTPDDNDIVRELDA
YEFAGFEYINRLTMYEEEGGETGLSVFPEFLGQGQKGEPGEPLIKGEKGDRGEPGLMGSQ
GIKGEPGDPGPPGLIGSPGLKGLPGEHGIPGKQGTKGEKGDPGGIVGPPGLPGPKGEAGP
PGKSLPGDPGLDGNPGAPGPRGPKGERGLPGVQGSPGDAGQPGMGIPGRTGSQGPAGEPG
VQGPRGLPGLPGTPGNDGAPGRDGKPGLPGPPGDPIALPLLGDIGALLKNFCANCQANVP
GLKSDKGDEGGAGEPGKYDSLAQKGDMGPRGPPGIPGREGPKGAKGERGYPGIPGEKGDE
GLQGIPGIPGAPGLTGPPGLIGRTGHPGPVGTKGDKGSEGPPGKPGPPGPPGIPLNEGNG
MSSLYKIQGGMNVPSYPGPPGPPGPKGDPGPVGEPGAMGLPGLEGFPGMKGDRGPAGSPG
IAGIGGKPGAPGPPGVPGEPGERGPVGDIGFPGPEGHPGKPGINGKDGLPGPQGLVGKPG
DRGPKGERGDQGIPGDRGPQGERGKPGLMGTKGTIGPMGPPGSKGSIGSPGHQGPPGSPG
LPGTPADAVSFEEIKKYINQEVLRIFEERMAVFLSQLKLPAAMLAAQAHGRPGPPGKDGL
PGPPGDPGPQGCPCAAPDIVYSWTARGSGFPEGHLLITKLEGTEDRKEKEGNLELGYQGA
QAFLGLQAPRAPRGPRAPLDPVEDVIPRTACTLCPMPISRQVESEHT
Download sequence
Identical sequences G5ALV0
HGL_H00000316030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]