SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000316042 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000316042
Domain Number 1 Region: 6-168
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.09e-41
Family Canonical RBD 0.0000833
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000316042
Sequence length 176
Comment HNRNPA0 (Homo_sapiens) heterogeneous nuclear ribonucleoprotein A0
Sequence
MENSQLCKLFIGGLNVQSGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADA
AMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDLIEHFSQFGT
VEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVVGVCNAVKS
Download sequence
Identical sequences G5B1W1
HGL_H00000316042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]