SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000316109 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000316109
Domain Number 1 Region: 393-505
Classification Level Classification E-value
Superfamily SMAD/FHA domain 9.95e-23
Family FHA domain 0.0024
Further Details:      
 
Weak hits

Sequence:  HGL_H00000316109
Domain Number - Region: 21-75
Classification Level Classification E-value
Superfamily Tropomyosin 0.0281
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000316109
Sequence length 701
Comment AGGF1 (Homo_sapiens) angiogenic factor with G patch and FHA domains 1
Sequence
MASEAPSPPPSPSRSLSPPTSPEPELAQLRRKVEKLERELRSCKRQVREIEKLLHHTERL
YQSAESNNQELRTQVEELSKILHCGRSEDNKKSDVEVQTENHASWSSSDYYHQTYYNDDC
PPNKETEFSVQQSQYTEAPPFNSKDQSQIESDTCTSTDVTGNVKGEQEDHFMSDSQEPTS
ALATEGASSEGSSLAESLRAAAEAAVSQTGFSYDESTGLYFDHSTGFYYDSENQLYYDPS
TGIYYYCDVESGRYQFHSRIDLQPYQSATTKQSKNKKLKKKRKDPDCSSTNEEKDLNSEN
QKASSVEYLNCSEGENFAHVKKKVKIDSVESPVNENISNSASFKDEIIIESDSEPEEGEI
TDSQTEGSYDEDITSEDNRTEEETEDEDEEKIWPPCIRVIVIRSPVLQTGSLFIITAVKP
ATIGREKDMEHTLRIPEVGVSKFHAEIYFDHELQSYVLVDQGSQNGTIVNGKHILQPKTK
CDPYVLEHGDEVKIGETVLSFHIHPGSDTCDGCEPGQVRAHLRLDKKDESFVGPALSKEE
KELERRKELKKIRVKYGLQNTDYEDEKALKNPKYKDRAGKRREQVGSEGTFQRDDAPASI
HSEITDSNKGRKMLEKMGWKKGEGLGKDGGGMKTPIQLQLRRTHAGLGTGKTSSIEDVPL
LQSKSKKNWDKARERFAESFPETKPPKDAPGTTPWVKGTVE
Download sequence
Identical sequences G5ATK2
HGL_H00000316109 XP_004870232.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]