SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000316136 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000316136
Domain Number 1 Region: 148-346
Classification Level Classification E-value
Superfamily E set domains 1.21e-73
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000515
Further Details:      
 
Domain Number 2 Region: 41-164
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.51e-20
Family Voltage-gated potassium channels 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000316136
Sequence length 372
Comment KCNJ1 (Homo_sapiens) potassium inwardly-rectifying channel, subfamily J, member 1
Sequence
MFKHLRKWFVTHFSGRSRQRARLVSKDGRCNIEFGNVDVQSRFIFFVDIWTTVLDLKWRY
KMTIFISAFLGSWFLFGLLWYVVAYIHKDLPEFHPPDNHTPCVENINGMTSAFLFSLETQ
VTIGYGFRCVTEQCATAIFLLVFQSILGVVINSFMCGAILAKISRPKKRAKTITFSKNAV
ISKRGGKLCLLIRVANLRKSLLIGGHIYGKLLKTTVTPEGETIILDQTNINFVVDAGNEN
LFFISPLTIYHIIDHNSPFFHMAAETLSQQEFELVVFLDGTVESTSATCQVRTSYVPEEV
LWGYRFVPIVSKTKDGKYRVDFHNFSKTVQVETPHCAMCLYNEKDARVRTKIGYDNPNFV
LSEVSETDDTKM
Download sequence
Identical sequences G5BRN5
XP_004862670.1.39548 XP_012934296.1.39548 HGL_H00000316136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]