SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000316385 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000316385
Domain Number 1 Region: 9-392
Classification Level Classification E-value
Superfamily Ras GEF 1.7e-91
Family Ras GEF 0.00072
Further Details:      
 
Domain Number 2 Region: 489-543
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000209
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.002
Further Details:      
 
Domain Number 3 Region: 402-483
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000115
Family Polcalcin 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000316385
Sequence length 609
Comment RASGRP2 (Homo_sapiens) RAS guanyl releasing protein 2 (calcium and DAG-regulated)
Sequence
MASTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSELAAKLLHIY
PSQACLGPVVSVHQYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIESVPT
YKWKRQVTQRNPMEQKKRKMSLLFDHLEPLELAEHLTYLEYRSFCKILFQDYHSFVTHGC
TVDNPVLERFISLFNSVSQWVQLMVLSKPTAPQRALVITHFVHVAEKLLQLQNFNTLMAV
IGGLSHSSISRLKDTHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACVGFRFPILGV
HLKDLVALQLALPDWLDSARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDLLSLLTV
SLDQYQTEDELYQLSLQREPRSKSSPASPTSCTPPPRPPVLEEWTSAAKPKLDQALLADH
IEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDENQDGCISREEMVSYFLR
SSSVLGGRMGFVHNFQESSSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCKDRLSV
ECRRRAQSVSLEGSAPSPSPTHTHHRAFSFSLPRPGRRGSRAPGFPPPSSIGARCGARGS
LFAAGPMAL
Download sequence
Identical sequences G5B6P1
HGL_H00000316385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]