SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000316605 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000316605
Domain Number 1 Region: 387-574
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-43
Family cAMP-binding domain 0.00034
Further Details:      
 
Domain Number 2 Region: 151-380
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.27e-25
Family Voltage-gated potassium channels 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000316605
Sequence length 724
Comment CNGB3 (Homo_sapiens) cyclic nucleotide gated channel beta 3
Sequence
DKISKKDSCDLPANPDPQCPAKPITAVPEQKEMGTGKEGPNRPISICSFLSFSPLGVPVI
NEYADAQLHNLMKKMHQRTALYKRKLIEREISLPEDSPHTAKPIMAPSTQESNSNLKNEH
HDGILHWRFQKLPLTKYLKRMRLPRSIDSHTDRLYLLWLLLVTIAYNWNCWLIPLRVVFP
YQTPDNTHYWLITDIICDIIYLCDMLLIQPRLKFIRGGEIIVDSTELKRHYRNSTKFQLD
MASIIPFDVFYLFLGYNPIFRTNRILKYTSFFEFNHHLESIMDKVYIYRVIRTTGYLLFI
LHINACIYYWASNYEGIGTTKWVYNGEGNKYLRCYYWAVRSLITIGGLPEPQTLFEIVFQ
LLNFFSGVFVFSSLIGQIRDVIGAATANQNNFRVCMDHTIAYMNTYSIPQSVQSRVRTWF
EYTWYSQRMLDESDLLENLPTTMQLALAADMNFSIISKVDLFKGCDTQMIYDILLRLKST
IYLPGDFVCKKGDIGKEMYIIKQGEIQVLGGPDGAQVLVTLKAGAVFGEISLLAMGGGNR
RTADVVAHGFANLLTLDKKTLEEILVHYPDSEKLLIKKARVLSKQKDKPKEETSPRKELA
FFFAPKQETPKMFKALLGGRGKVDLGRLLKLKREKRAQKKSGNSKGEGGKRKKDEDKGRG
PSEKTLDRSKDEASSITTEEKPQSIRRAVLPRETSCQSLVITMAPSAETGEEVLTIEVKE
KSKQ
Download sequence
Identical sequences G5BPJ8
HGL_H00000316605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]