SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000316638 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000316638
Domain Number 1 Region: 305-637
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 1.83e-35
Family Tricorn protease domain 2 0.025
Further Details:      
 
Domain Number 2 Region: 170-235
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000038
Family Canonical RBD 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000316638
Sequence length 769
Comment EIF3B (Homo_sapiens) eukaryotic translation initiation factor 3, subunit B
Sequence
MQDAENVAAPEAADERPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXPAPQVEAEPLGDQASEQCAEEAVRPEGSAAEAEPRAVENGEADEPSF
SDPEDFVDDVSEEELLGDILKDRPQEADGIDSVIVVDSVPQVGPDRLEKLKNVIHKIFSK
FGKITNDYYPEEDGKTKGYIFLEYASPAHAVDAVKSADGYKLDKQHTFRVNLFTDFDKYM
TISDEWDIPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERA
RWTETYVRWSPKGTYLATFHQRGIALWGGDKFKQIQRFSHQGVQLIDFSPCERYLVTFSP
LMDTQDDPQAIIIWDILTGHKKRGFHCESSAHWPIFKWSHDGKFFARMTMDTLSIYETPS
MGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPSRQEIRVRNLFNVV
DCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMKETIIAFAWEPN
GSKFAVLHGEAPRISVSFYHVKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNG
ALAFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQK
NNKDRFCQLLWRPRPPTLLSQEQIKVWAPLQAQGVEAIMELVERRRTMMEDFRKYRKMAQ
ERYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIPLGNQE
Download sequence
Identical sequences G5BF50
HGL_H00000316638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]