SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000316746 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000316746
Domain Number 1 Region: 413-500
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.92e-21
Family PLC-like (P variant) 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000316746
Sequence length 554
Comment PRF1 (Homo_sapiens) perforin 1 (pore forming protein)
Sequence
MAAHLLFLGILLLLPLRAPAPCYTAGPSECKQKRNFVPGAWLAGEGVDVTSLRRSHSFPV
DTHRFLRPDGTCTLCKNALQGGAMQLLPLALDHWRAEGSGCQHHVSKAEVSSTEAVAGEA
ASTITNDWKAGLGVSPNPSVNVQMSVAGSHSQAANFAAEKSHRDQYSFSTDRVECRLYSY
RLVYTPPLHPDFRKALRELPPRLNSSTEPDYHRLISNYGTHFIRAVELGGRISALTALRT
CELALEGLTADDVGDCLNVEAQVSISGHASSSSEYRACEEKKKHHKMATSFHQAYRERLF
EVVGGHQESMYDLLFGSKAGPEQFSAWVTSLYKKPGLVDYSLEPLHVLVETQDPRREALK
QALSKYLMGRARWKDCSRPCPPGQQKSPHDLCQCVCHSSAVTTKDCCPSHRGLARLEVTI
VQARNLWGDWITDSDAYVKVFFGKQELRTGTVWNNNNPRWATRLDFGDVLLPTGGPLRVQ
VWDADNGWDDDLLGSCDRSPMSGSHEETCHMNHGDLTFHYRARCLTHLTGPTCMEYAPQG
LLGEPPGNRSGAVW
Download sequence
Identical sequences G5B1A0
HGL_H00000316746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]