SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000316840 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000316840
Domain Number 1 Region: 369-521
Classification Level Classification E-value
Superfamily TRAF domain-like 2.62e-46
Family MATH domain 0.0000000277
Further Details:      
 
Domain Number 2 Region: 66-138
Classification Level Classification E-value
Superfamily RING/U-box 1.2e-18
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 188-281
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000131
Family SIAH, seven in absentia homolog 0.012
Further Details:      
 
Domain Number 4 Region: 131-187
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000405
Family SIAH, seven in absentia homolog 0.01
Further Details:      
 
Weak hits

Sequence:  HGL_H00000316840
Domain Number - Region: 314-367
Classification Level Classification E-value
Superfamily Tropomyosin 0.0569
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000316840
Sequence length 543
Comment TRAF6 (Homo_sapiens) TNF receptor-associated factor 6
Sequence
MSLINCENSCGSSQSESDCCAAMASSCSTAAKDDSVSGVPSTSTGNLSSSFMEEIQGYDV
EFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLF
PDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQVLCEFALVNCSQCQRPFQKCQLNIHI
LTDCPRRQVSCVNCAVSMPFEEKEIHDQNCPLANVICEYCHTMLIREQMPTHYDLDCPTA
PIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLNLALTPVPPRDLLPYDAA
SLPRVSSGCHPEVQNFQETIQQLEGRLVRQDHQIRELTAKMETQCMYVNELKGTIRTLED
KVAEIEAQQCNGIYIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPT
AQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAF
QRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGGLRKEGFQPRSTD
AGV
Download sequence
Identical sequences G5B132
HGL_H00000316840 XP_004852082.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]