SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000316950 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000316950
Domain Number 1 Region: 462-542
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.07e-24
Family Canonical RBD 0.0035
Further Details:      
 
Domain Number 2 Region: 61-169
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.49e-24
Family Canonical RBD 0.004
Further Details:      
 
Domain Number 3 Region: 172-283
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.24e-23
Family Canonical RBD 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000316950
Sequence length 544
Comment MYEF2 (Homo_sapiens) myelin expression factor 2
Sequence
MGPHDRGDPPSRAACASTRAHRENDESVKEEKSDLKEKSTGNKKANRFHPYSKDKNSGTG
EKKGPNRNRVFISNIPYDMKWQAIKDLMREKVGEVTYVELFKDAEGKSRGCGVVEFKDEE
FVKKALETMNKYDLSGRPLNIKEDPDGENARRALQRTGGSFPGGHAPEMGTGLMNLPPSI
LNNPNIPPEVISNLQAGRLGSTIFVANLDFKVGWKKLKEVFSIAGTVKRADIKEDKDGKS
RGMGTVTFEQAIEAVQAISMFNGQFLFDRPMHVKMDDKSVPHEDYRSHDSKTPQLPRGLG
GIGMGLGPGGQPISASQLNIGGVMGNLGPSGMGMDGPGFGGMNRIGGGIGFGGLEAMNSM
GGFGGVGRMGELYRSAMTSSMERDFGRGDIGINRGFGDSFGRLGGGMGGMSSVTGGMGMG
LDRVSSSFDRMGPGIGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTW
QKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFDSPESAEKACRIMNGIKISGREIDVRL
DRNA
Download sequence
Identical sequences G5BR19
HGL_H00000316950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]