SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000317128 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000317128
Domain Number 1 Region: 16-358
Classification Level Classification E-value
Superfamily Sema domain 3.92e-51
Family Sema domain 0.013
Further Details:      
 
Domain Number 2 Region: 1222-1346,1512-1708
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.9e-31
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 790-880
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000259
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.039
Further Details:      
 
Domain Number 4 Region: 699-791
Classification Level Classification E-value
Superfamily E set domains 0.000000000000044
Family Other IPT/TIG domains 0.016
Further Details:      
 
Domain Number 5 Region: 878-965
Classification Level Classification E-value
Superfamily E set domains 0.0000000000131
Family E-set domains of sugar-utilizing enzymes 0.055
Further Details:      
 
Domain Number 6 Region: 361-413
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000772
Family Plexin repeat 0.003
Further Details:      
 
Weak hits

Sequence:  HGL_H00000317128
Domain Number - Region: 1016-1070
Classification Level Classification E-value
Superfamily E set domains 0.000224
Family E-set domains of sugar-utilizing enzymes 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000317128
Sequence length 1751
Comment PLXND1 (Homo_sapiens) plexin D1
Sequence
MTGRLRMPVPSSSCTVQPRSLSRLLVGATYTGFGSAFFPRNRSLEDHRFENTPEVAIRSL
DAQGDPARLFTFDLNPSDDNVLKIKQGAKERHRLRFVRAFLHPPGVQPYAYLAFTSEARA
GDKDGQARSLLARICLPRGDAKKLTESYIELGLQCAGGAGRGDLYSRLVSVFPARERLFG
VFERPPAIPAPRTAPAPAALCAFLFADVQAAIRSARAACFVEPAAGVVAVLDSVVQGTGP
ACDRKRNLQLQPEQLDCGAAHLQHPLTILQPLKATPVFRAPGLTAVAVASANNYMAVFLG
TATGRLLKLSLNESMQVVSRRMVTVAYGEPVHPIMQFDPTDPSYLYLMTSHQMARVKVAA
CEAHATCGDCVGAADAYCGWCVLETRCTMQQDCDNSSQPHFWTSASEGPSRCPAMAVLPA
EIDVHLEHPGMILQVSGSLPSLSGLEMACDYGNGIHTVARVPGPADGHQITYCNLLPRDH
FPAFPPQQDHVTVEMSLRVHGRAIVSANFTIYDCSRVAHVAPSTACTSCLSARWPCFWCT
EQHICISNQSQCQASSNPKSPRDCPQTLPSPLAPAPTGGAQDILVPLANAASFHGAVLQC
SFGLEDNFEAVWVNESAIRCSHVVLHTAQKSQMFLLSLQLQGQPPRFLDSPDPMTVVVYN
CAMGSPDCSQCLGREDLGHLCMWSDGCRSRGPLPPQPGTCPAPEIHTIEPLSGPLDGGTL
LTIRGRDLGRRLSDVAHSVWIGSVACELLANRYIVSEEIVCVTGPATAAFSDVVTVNMSK
EGTSRERFSYVLPQVHSLEPAVGPTAGGTRITIHGSDLHVGSKLQVLVNDTDPCTELVRS
DTSIACTMPAGALPAPVPVCVRFERRGCAHGNLSFTYMRNPVIMAISPRRSPVSGGRTIT
VAGERFHMVQNVSMAVHRIGREPTLCKVLNATLITCPSPGALHNASAPVAFFINGRVYVD
EAPYEPLPDPEEMPRGGRFHLDYLPNPQFSTARRERWIRHHPGEPLTLVIHKEQDGLGLE
SHEYQVKIGQVACDIQIVSDRVIHCSVNDSLDAAEGQLPITVQVGNFNQTIATLQLGGSE
TTIVASIVIFSVLLLLSVVALFFFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAEL
QTDMTDLTKELSRSQGIPFLEYKHFVTRTFFPKCSSLYEERYMLPLQSLGSKGGLPVQET
HPLLGEWNVPENCRPSMEEGISLFSSLLSNKHFLIIFVHALEQQKDFAVRDRCSLASLLT
IALHGKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSICMYSCLRET
VGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDS
LSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFATSTQSYILRDLDDTSVV
EDGRKKLNTLAHYKIPEGASLAMSLTDKKDNTLGRVKDLDTEKYFHLVLPTDELAEPKKS
HRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYFFDFLEEQAE
KRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIEKTDHIDACLTVIAQAFIDACSIS
DLQLGKVGFLGGTVEWGGSHRDSPTNKLLYAKEIPEYRKVVQRYYKQIQDMAPLSEQEMN
AHLAEESRKYQNEFNTNVALAEVYKYAKRYRPQIVTALEANPTARRTQLQHKFEQVVALM
EDNIYECYSEA
Download sequence
Identical sequences G5BYE5
HGL_H00000317128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]