SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000317159 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000317159
Domain Number 1 Region: 29-220
Classification Level Classification E-value
Superfamily Cytochrome c 7.68e-74
Family Cytochrome bc1 domain 0.00000000805
Further Details:      
 
Domain Number 2 Region: 221-266
Classification Level Classification E-value
Superfamily Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 5.36e-16
Family Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000317159
Sequence length 266
Comment CYC1 (Homo_sapiens) cytochrome c-1
Sequence
MLSALGILAAGGAGLAVALHSAVSASDLELHPPNYPWSHRGLFSSLDHTSIRRGFQVYKQ
VCSSCHSMDYLAFRHLVGVCYTEEEAKALAEEVEVQDGPTEDGEMFMRPGKLSDYFPKPY
PNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPG
QAIAMAPPIYTDVLEFDDGTPATMSQVAKDVCTFLRWASEPEHDNRKRMGLKMLMMMGLL
LPLIYAMKRHKWSVLKSRKLAYRPPK
Download sequence
Identical sequences G5C5T9
HGL_H00000317159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]