SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000317214 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000317214
Domain Number 1 Region: 1-290
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.14e-80
Family Calpain large subunit, catalytic domain (domain II) 0.00000158
Further Details:      
 
Domain Number 2 Region: 317-440
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.12e-29
Family Calpain large subunit, middle domain (domain III) 0.00048
Further Details:      
 
Domain Number 3 Region: 462-575
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.93e-17
Family Synaptotagmin-like (S variant) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000317214
Sequence length 584
Comment CAPN6 (Homo_sapiens) calpain 6
Sequence
DICDDPHLIVGNISHHQLIQGRLGHKLMVPAFSCLAVQESHWTKTIPNHKEQEWDPRKPD
KYAGIFRFRFWHFGEWIEVVIDDLLPTINGDLVFSFSTSMNEFWNALLEKAYAKLLGCYE
ALDGLTITDIIVDFTGTLAEIVDMQKGRYTELVEEKYKLFRELYKTFTKGGLICCSIESP
SQEEQEVETDWGLLKGNTYTMTDIRKIRLRERLTEVFSAEKLYMVRLRNPLGKQEWSGPW
SEISEEWQQLTSADHKNLGLVMCDDGEFWMSLEDFCCNFHKLNVCRNVNNPVLGHKELHL
VLGCWTVDDDPLMNRCCYNNRDTFLQNPQYIFTVPEDGHKVIMSLQQKDLRTYRRMGRPD
NYIIGFELFKVEMNRKFRLHHLYIQERAGTSTYIDTRTVFLSKYLKKGNYVLVPTMFQHG
RTSEFLLRIFSEVPIQLRELTLDMPKMSCWNLARGYPKVVTQITIHSAEGLEKKNANETV
NPYLVIKCGKEEVRSPVQKNTVHAIFDTQAIFYRRTTDIPIIVQVWNRQKFCDHFLGQVT
LDANPSDCHELKSLYLRKKGGPTAKVKQGHISFKVISSDDLTEL
Download sequence
Identical sequences G5C7Y7
HGL_H00000317214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]